PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00056.1_g00039.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 299aa    MW: 33202.2 Da    PI: 5.5097
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00056.1_g00039.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.3e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l+ + +++G g W+t +++ g+++++k+c++rw +yl
  Rsa1.0_00056.1_g00039.1 14 KGAWTPEEDQKLIAYLQRHGEGGWRTLPEKAGLKKCGKSCRLRWANYL 61
                             79******************************99************97 PP

2Myb_DNA-binding491.4e-1567111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg +++eEd+ +++++++ G++ W++Ia ++  gRt++++k++w++ 
  Rsa1.0_00056.1_g00039.1  67 RGEFSPEEDDTIIKLHALKGNK-WAAIATYLA-GRTDNEIKNYWNTN 111
                              899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-23564IPR009057Homeodomain-like
PROSITE profilePS5129415.937961IPR017930Myb domain
SuperFamilySSF466899.36E-2911108IPR009057Homeodomain-like
SMARTSM007172.2E-121363IPR001005SANT/Myb domain
PfamPF002492.5E-151461IPR001005SANT/Myb domain
CDDcd001671.56E-91661No hitNo description
PROSITE profilePS5129425.27462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2565117IPR009057Homeodomain-like
SMARTSM007173.2E-1666114IPR001005SANT/Myb domain
PfamPF002496.1E-1567112IPR001005SANT/Myb domain
CDDcd001672.23E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MVRTPCCKEE GIRKGAWTPE EDQKLIAYLQ RHGEGGWRTL PEKAGLKKCG KSCRLRWANY  60
LRPDIKRGEF SPEEDDTIIK LHALKGNKWA AIATYLAGRT DNEIKNYWNT NLKKRLKQKG  120
IDPTTHKPIN STDQTRIGPK KLKLSSSGSA RVLNRVASKY AVDLNRDLVT GIIIGNSSTT  180
ITDVSQNSEV ENSTITLLNK TSTSSGFSDN CSFSDGFTEF FSNEEISDMS MSLDHVGLME  240
ELKGILSYDN AGAGEIKGSP EANVSDEMEF LIDYWNVEDD QDLEKFVSSL DSNTGGVVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26141167108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKRLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX9461810.0JX946181.1 Eruca vesicaria subsp. sativa MYB34 protein (MYB34-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610139.10.0PREDICTED: transcription factor MYB34-like
RefseqXP_013610140.10.0PREDICTED: transcription factor MYB34-like
SwissprotO643991e-148MYB34_ARATH; Transcription factor MYB34
TrEMBLA0A078DD490.0A0A078DD49_BRANA; BnaC09g05060D protein
TrEMBLA0A0D3E1N50.0A0A0D3E1N5_BRAOL; Uncharacterized protein
STRINGBra035954.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93311637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60890.11e-139myb domain protein 34